PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.007G122600.1.p
Common NameSb07g019940, SORBIDRAFT_07g019940
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family LBD
Protein Properties Length: 430aa    MW: 45879.5 Da    PI: 4.4629
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.007G122600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260125.13.4e-3978176199
                DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleq 89 
                           aCaaCk++rrkC++dC+lapyfpa+q+++f n+h+lFG+sn+lk+lk+l++e   dam +l+y++++ra+dPv G++++il+l++qle 
  Sobic.007G122600.1.p  78 ACAACKYQRRKCNPDCPLAPYFPADQQRRFLNAHRLFGVSNILKTLKKLRPELCADAMGTLIYQSDMRAQDPVGGCYRLILSLERQLEI 166
                           7**************************************************************************************** PP

                DUF260  90 lkaelallke 99 
                           + ael+++ +
  Sobic.007G122600.1.p 167 ETAELSAVLH 176
                           *****98866 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.07477178IPR004883Lateral organ boundaries, LOB
PfamPF031958.0E-3778174IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 430 aa     Download sequence    Send to blast
MTSSVAPTTA ASHLHITTTT ATATGTTSAI TSPSSNHSLS NAHARSSPHS ASSSPRGSST  60
TGGTGGGSGS GSGSTNQACA ACKYQRRKCN PDCPLAPYFP ADQQRRFLNA HRLFGVSNIL  120
KTLKKLRPEL CADAMGTLIY QSDMRAQDPV GGCYRLILSL ERQLEIETAE LSAVLHHLAL  180
CRQATTAATA MPPQQQQQGG GMADLDVTSS NQPLLLNAQQ EVVDALYTTT HEADTAILPT  240
DEVVHHSPKD DHGEQQQQQL FDYFYYDATA SDDASSKPTI DINLDNMQQF DFDDSCAAAD  300
DDKVDLTAPA GPDEEIRHHQ QHLDVNCGQI DDHKDYFEIK AASLVDAFDM RQELQPVVDV  360
NAGVEIDIKA VDVNAGIGVD IKAMDMNANV DVNVDLQEED GAINVSTAEA AQMAAESSHC  420
RLGLGFSSF*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.60810.0pollen
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9635040.0EU963504.1 Zea mays clone 263389 hypothetical protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002444306.10.0hypothetical protein SORBIDRAFT_07g019940
TrEMBLC5YKR70.0C5YKR7_SORBI; Putative uncharacterized protein Sb07g019940
STRINGSb07g019940.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP52283461
Representative plantOGRP55241021
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.12e-38LOB domain-containing protein 22